General Information

  • ID:  hor004025
  • Uniprot ID:  A0A0L0BYE3
  • Protein name:  Pyrokinin
  • Gene name:  NA
  • Organism:  Lucilia cuprina (Green bottle fly) (Australian sheep blowfly)
  • Family:  Pyrokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lucilia (genus), Luciliinae (subfamily), Calliphoridae (family), Oestroidea (superfamily), Calyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  SVQFKPRL
  • Length:  8
  • Propeptide:  MTGLSCLTFVLVAFCCYTMSMSKPTRKEAAKKVELPHEQQQQQPHHPQLQSEATYETRQKRSQLDLGNIGGGTNGFGNTEYKDFNEFMEELGDNAIMPVSQEMDLENMPPLLYFMLLQKLKQLQTNERQLPTRRTPRLGRSIDFQLFDAGAATTTGHDFDGALNMANDYAVSRQYLPRVMKKSVQFKPRLGKRTQVCD
  • Signal peptide:  MTGLSCLTFVLVAFCCYTMSMS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A0L0BYE3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004025_AF2.pdbhor004025_ESM.pdb

Physical Information

Mass: 109920 Formula: C45H75N13O11
Absent amino acids: ACDEGHIMNTWY Common amino acids: FKLPQRSV
pI: 11.65 Basic residues: 2
Polar residues: 1 Hydrophobic residues: 3
Hydrophobicity: -43.75 Boman Index: -1747
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 85
Instability Index: -3831.25 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  23280433
  • Title:  Neuropeptidomics of the Australian Sheep Blowfly Lucilia Cuprina (Wiedemann) and Related Diptera